Share this post on:

Name :
Recombinant Human IL5RA

Specification :
| Description : The protein encoded by this gene is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL5 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL5. This protein has been found to interact with syndecan binding protein (syntenin), which is required for IL5 mediated activation of the transcription factor SOX4. Several alternatively spliced transcript variants encoding four distinct isoforms have been reported. | Biological activity : The ED50 of IL5RA – Fc Chimera is typically 0.25 – 0.4ug/ml as measured by its ability to neutralize IL-5 mediated proliferation of the human growth factor dependent TF-1 cell line. | Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. | Purity : >95% by SDS-PAGE | Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS | Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. | Sequences of amino acids : Theoretical Sequence:DLLPDEKISLLPPVNFTIKVTGLAQVLLQ WKPNPDQEQRNVNLEYQVKINAPKEDDY ETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAE LHAPPGSPGTSIVNLTCT TNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRY GSWTEECQEYSKDTL GRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQL FALHAIDQINPPLNVTA EIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIE KLMTNAFISIIDDLSKYDV QVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWGSSN TKVDKKVEPKSCDK THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKE YKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFY PSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLS PGK

Gene Information :
| Gene Name : IL5RA interleukin 5 receptor, alpha [ Homo sapiens ] | Official Symbol : IL5RA | Synonyms : IL5RA; interleukin 5 receptor, alpha; IL5R; interleukin-5 receptor subunit alpha; CD125; CDw125; | Gene ID : 3568 | mRNA Refseq : NM_000564 | Protein Refseq : NP_000555 | MIM : 147851 | Uniprot ID : Q01344 | Chromosome Location : 3p26-p24 | Pathway : Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; | Function : interleukin-5 receptor activity; protein binding; receptor activity;

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
BNIP3/NIP3 ProteinSynonyms
DKK-1 Proteinweb
Popular categories:
PSBG1 Protein/CD66f
Receptor Serine/Threonine Kinases

Share this post on:

Author: Cholesterol Absorption Inhibitors