Name :
Recombinant Human CEACAM3 Protein, His-SUMO-tagged
Specification :
| Source : E. coli | Species : Human | Tag : His-SUMO | Form : Tris-based buffer, 50% glycerol. | Molecular Mass : 29.1 kDa | AA Sequence : KLTIESMPLSVAEGKEVLLLVHNLP QHLFGYSWYKGERVDGNSLIVGYVI GTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDL VNEEATGQFHVYQENAPGLPVGAVA G | Purity : Greater than 90% as determined by SDS-PAGE. | Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Information :
| Gene Name : CEACAM3 carcinoembryonic antigen-related cell adhesion molecule 3 [ Homo sapiens ] | Official Symbol : CEACAM3 | Synonyms : CEACAM3; carcinoembryonic antigen-related cell adhesion molecule 3; CD66d antigen; OTTHUMP00000196409; carcinoembryonic antigen CGM1; carcinoembryonic antigen gene family member 1; nonspecific cross-reacting antigen; CEA; CGM1; W264; W282; CD66D; MGC119875 | Gene ID : 1084 | mRNA Refseq : NM_001815 | Protein Refseq : NP_001806 | MIM : 609142 | UniProt ID : P40198
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
AMIGO2 Protein
IL-12R beta 1 Protein
Popular categories:
G Protein-Coupled Receptor Class C Group 5 Member D (GPRC5D)
ALK-2/ACVR1
