Name :
Recombinant Human CEACAM8
Specification :
| Description : Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8) also known as CD66b (Cluster of Differentiation 66b), is a human gene. | Protein length : 349 amino acids | Molecular Weight : 64.390kDa inclusive of tags | Source : Wheat germ | Tissue specificity : Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow. | Form : Liquid | Purity : Proprietary Purification | Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | Sequences of amino acids : MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEA VPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRII GYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSY TLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDK DAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTL TLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAP TISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQY TQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD ALVQGSSPGLSARATVSIMIGVLARVALI | Sequence Similarities : Belongs to the immunoglobulin superfamily. CEA family.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Information :
| Gene Name : CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens ] | Official Symbol : CEACAM8 | Synonyms : CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b; | Gene ID : 1088 | mRNA Refseq : NM_001816 | Protein Refseq : NP_001807 | Uniprot ID : P31997 | Chromosome Location : 19q13.2
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD204/MSR1 Protein
Animal-Free G-CSF Protein
Popular categories:
Fc-gamma Receptor I/CD64
CCR4
