Share this post on:

Name :
Recombinant Human CLEC5C Protein, His-SUMO-tagged

Specification :
| Source : E. coli | Species : Human | Tag : His-SUMO | Form : Tris-based buffer, 50% glycerol. | Molecular Mass : 36 kDa | AA Sequence : NFMYSKTVKRLSKLREYQQYHPSLT CVMEGKDIEDWSCCPTPWTSFQSSC YFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSS YFLGLSDPGGRRHWQWVDQTPYNEN VTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMK KIYI | Purity : Greater than 90% as determined by SDS-PAGE. | Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information :
| Gene Name : CLEC4C C-type lectin domain family 4, member C [ Homo sapiens ] | Official Symbol : CLEC4C | Synonyms : DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150 | Gene ID : 170482 | mRNA Refseq : NM_203503.1 | Protein Refseq : NP_987099.1 | MIM : 606677 | UniProt ID : Q8WTT0

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-21 Protein
Flagellin Protein
Popular categories:
Basal Cell Adhesion Molecule (BCAM)
ALK-1/ACVRL1

Share this post on:

Author: Cholesterol Absorption Inhibitors