Recombinant Human CXCR4, His-tagged

Specification :
| Description : This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. | Source : Yeast | Species : Human | Tag : His | Form : Liquid | Molecular Mass : 42.2 kD | AA Sequence : MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANF NKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKY RLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIY TVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVV YVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWV VVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRK ALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEF ENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHA LTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS | Purity : >90 % | Characteristic : Please inquire if you are interested in this recombinant protein expressed in E. coli, mammalien cells or by baculovirus infection. Be aware about differences in price and lead time. | Applications : ELISA | Storage : Store at -20°C. For extended storage, conserve at -20°C or -80°C | Concentration : 0.2-2 mg/mL | Storage Buffer : Tris-based buffer, 50 % glycerol | Warning : Repeated freezing and thawing is not recommended. Store working aliquots at 4 °C for up to one week.