Name :
Recombinant Human FCGR2B protein, Myc/DDK-tagged
Specification :
| Description : The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. | Source : HEK293T | Species : Human | Tag : Myc/DDK | Form : 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol | Molecular Mass : 31.7 kDa | AA Sequence : myc-FLAG tag | Product-Related Proteins : TA50011-100LC424200 TA358460 RC219569 | Purity : > 80% | Usage : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | Storage : Store at -80 centigrade. | Concentration : >50 ug/mL
Gene Information :
| Gene Name : FCGR2B Fc gamma receptor IIb [ Homo sapiens (human) ] | Official Symbol : FCGR2B | Synonyms : CD32; CD32B; FCG2; FCGR2; FCGR2C; FcRII-c; IGFR2 | Gene ID : 2213 | mRNA Refseq : NM_001002273 | Protein Refseq : NP_001002273 | MIM : 604590 | UniProt ID : P31994
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FGF-9 proteincustom synthesis
LRRC32 ProteinBiological Activity
Popular categories:
Angiopoietin Like 2
TL1A
