Name :
Recombinant Human GYPB Protein, GST-tagged
Specification :
| Description : Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. GYPB gene consists of 5 exons and has 97% sequence homology with GYPA from the 5 UTR to the coding sequence encoding the first 45 amino acids. In addition to the M or N and S or s antigens, that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta; also, Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. [provided by RefSeq | Source : Wheat Germ | Species : Human | Tag : GST | Molecular Mass : 29.81 kDa | AA Sequence : TTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPA | Applications : Enzyme-linked Immunoabsorbent AssayWestern Blot (Recombinant protein)Antibody ProductionProtein Array | Notes : Best use within three months from the date of receipt of this protein. | Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. | Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Information :
| Gene Name : GYPB glycophorin B (MNS blood group) [ Homo sapiens ] | Official Symbol : GYPB | Synonyms : GYPB; glycophorin B (MNS blood group); glycophorin B (includes Ss blood group) , glycophorin B (Ss blood group) , MNS; glycophorin-B; CD235b; GPB; SS; Ss blood group; glycophorin MiX; glycophorin HeP2; glycophorin MiVI; glycophorin MiIII; sialoglycoprotein delta; SS-active sialoglycoprotein; MNS; PAS-3; GPB.NY; HGpMiX; GpMiIII; HGpMiVI; GYPHe.NY; HGpMiIII; | Gene ID : 2994 | mRNA Refseq : NM_002100 | Protein Refseq : NP_002091 | UniProt ID : P06028
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Islet cell autoantigen 1/ICA1site
RANKL ProteinMedChemExpress
Popular categories:
IL-26
IGFBP-3
