Name :
Recombinant Human IGSF8, His-tagged
Specification :
| Description : This gene encodes a member the EWI subfamily of the immunoglobulin protein superfamily. Members of this family contain a single transmembrane domain, an EWI (Glu-Trp-Ile)-motif and a variable number of immunoglobulin domains. This protein interacts with the tetraspanins CD81 and CD9 and may regulate their role in certain cellular functions including cell migration and viral infection. The encoded protein may also function as a tumor suppressor by inhibiting the proliferation of certain cancers. Alternate splicing results in multiple transcript variants that encode the same protein. | Conjugation : HIS | Source : E. coli | Form : Lyophilised:reconstitution with 128 μl aqua dest. | Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | Sequences of amino acids : GCLARTSTQKHTHLAVSFGRSVPEAPVGRSTLQEVVGIRS DLAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQA GDAGTYHCTAAEWIQDPDGSWAQIAEKRAVLAHVDVQT LSSQLAVTVGPGERRIGPGEPLELLCNVSGALPPAGRHAA YSVGWEMAPAGAPGPGRLVAQLDTEGVGSLGPGYEGRH IAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSG TRLREAASARSRPLPVHVREEGVVLEAVAWLAGGTVYR GETASLLCNISVRGGPPGLRLAASWWVERPEDGELSSVPA QLVGGVGQDGVAELGVRPGGGPVSVELVGPRSHRLRLH SLGPEDEGVYHCAPSAWVQHADYSWYQAGSARSGPVTV YPYMHALDTLFVPLLVGTGVALVTGATVLGTITCCFMKRLRKR
Gene Information :
| Gene Name : IGSF8 immunoglobulin superfamily, member 8 [ Homo sapiens ] | Official Symbol : IGSF8 | Synonyms : IGSF8; immunoglobulin superfamily, member 8; immunoglobulin superfamily member 8; CD81P3; CD316; EWI2; PGRL; | Gene ID : 93185 | mRNA Refseq : NM_052868 | Protein Refseq : NP_443100 | MIM : 606644 | Uniprot ID : Q969P0 | Chromosome Location : 1q23.1 | Function : protein binding;
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Azurocidin Proteinmanufacturer
Adipolean/gAcrp30 ProteinPurity & Documentation
Popular categories:
Mannose Receptor
GLP-2 Receptor